Part Number Hot Search : 
2SJ213 MIC2562A E1C47 A6276ELW ZTX454 105K1 G2995 90SC15B
Product Description
Full Text Search
 

To Download OCI-440-IT940 Datasheet File

  If you can't view the Datasheet, Please click here to try to view without PDF Reader .  
 
 


  Datasheet File OCR Text:
  ceramics C high power oci - 440 it940 copyright ? 2013 osa opto light gmbh . all rights reserved www.osa - opto.com edition 5/13 page/seite 1 / 7 features: ? size 3,8(l) x 3,8(w) x 1,0(h) mm ? circuit substrate: aln ceramics ? devices are rohs and reach conform ? lead free solderable, soldering pads: silver plated ? taped in 12 mm blister tape, cathode to transporting perforation ? all devices sorted into luminous intensity classes ? taping: face - up (t) merkmale: ? gr??e: 3,8 x 3,8 x 1,0 mm ? geh?usematerial: aln keramik ? bauteile sind rohs und reach konform ? bleifrei l?tbar, l?tpads : versilbert ? gegurtet in 12 mm blistergurt, kathode zur transportperforation ? alle bauteile in intensit?tsklassen sortiert ? gurtung: face - up (t) ? electro - optical characteristics (t=25c) elektrooptische eigenschaften parameter symbol condition min typ max unit emitting color farbe infrared infrarot forward voltage flussspannung u f i f = 350 ma 1.40 1.8 0 v peak wavelength peak wellenl?nge p i f = 350 ma 925 940 955 nm fwhm halbwertsbreite ? i f = 350 ma 30 nm radiant intensity strahlst?rke i e i f = 350 ma 45 62 mw/sr reverse current sperrstrom i r u r = 5v 100 a
ceramics C high power oci - 440 it940 copyright ? 2013 osa opto light gmbh . all rights reserved www.osa - opto.com edition 5/13 page/seite 2 / 7 ? maximum ratings grenzwerte parameter symbol min max unit forward current flussstrom i f, max 500 ma forward current, pulsed flussstrom, gepulst t p 100s, ? =1:10 i f , pulse 10 00 ma reverse voltage sperrspannung u r 5 v thermal resistance w?rmewiderstand r ? _jc 10 k/w operating temperatur betriebstemperatur t op - 40 +85 c storage temperature lagertemperatur t st - 40 +85 c outline drawing zeichnung recommended soldering pad empfohlenes l?tpad marking at cathode markierung an der kathode 1.6 3.8 3.8 1.0 1.7 3.5 3.5
ceramics C high power oci - 440 it940 copyright ? 2013 osa opto light gmbh . all rights reserved www.osa - opto.com edition 5/13 page/seite 3 / 7 ? performace diagram kennlinien forward current vs. forward voltage flussstrom ber flussspannung intensity vs. forward current strahlst?rke ber flussstrom maximum forward current vs. ambient temprature max. flussstom ber umgebungstemperatur forward current vs. shift peak wavelength flussstrom gegen verschiebung der wellenl?nge spectrum spektrum view angle abstahlung 1 10 100 1,00 1,05 1,10 1,15 1,20 1,25 1,30 1,35 1,40 1,45 1,50 forward current [ma] forward voltage [v] 0,0 0,2 0,4 0,6 0,8 1,0 1,2 0 50 100 150 200 250 300 350 400 450 rel. intensity [a.u.] forward current [ma] -40 -20 0 20 40 60 80 100 0 50 100 150 200 250 300 350 400 t op [c] if [ma] 939,0 939,2 939,4 939,6 939,8 940,0 940,2 940,4 0 50 100 150 200 250 300 350 400 450 peak wavelength [nm] forward current [ma] 0,0 0,2 0,4 0,6 0,8 1,0 800 850 900 950 1000 1050 1100 rel .intensity [a.u.] wave length [nm] 0 30 60 90 120 150 180 0,0 0,5 1,0
ceramics C high power oci - 440 it940 copyright ? 2013 osa opto light gmbh . all rights reserved www.osa - opto.com edition 5/13 page/seite 4 / 7 ? soldering conditions l?tprofile ir reflow soldering profile for lead containig solder ir reflow l?tprozess fr bleihatiges lot ir reflow soldering profile for lead free soldering ir reflow l?tprozess fr bleifreies lot manual soldering : manuelles l?ten : max power of iron 25w / 300c for 3s max. leistung des l?tkolben 25w / 300c fr 3s 4k/s max 300 250 200 150 100 50 0 50 100 150 200 250 300 time [s] temperature [c] 10...20s 40s max. 230c 170c 120c 3k/s max. 120s max 3k/s max 10...20s 60s max 4k/s max 245c 217c 250c 180c 300 250 200 150 100 50 0 50 100 150 200 250 300 time [s] temperature [c] 3k/s max
ceramics C high power oci - 440 it940 copyright ? 2013 osa opto light gmbh . all rights reserved www.osa - opto.com edition 5/13 page/seite 5 / 7 ? ordering code for parts kodierung der bestellnummer series serie color farbe encapsulation verguss packaging verpackung oci - 440 - ??????? - ? - ? t C taped up x C uncolored clear type definition, e.g. oci - 440 it940 C x - t typenbezeichnung z.b. ? tape and reel packing gurt und spule d parts/reel 7 2 000
ceramics C high power oci - 440 it940 copyright ? 2013 osa opto light gmbh . all rights reserved www.osa - opto.com edition 5/13 page/seite 6 / 7 packing the reel is sealed in special plastic bag with integrate esd protection ( mil - std 81705 ) including a silica dry - pack . msl level acc. to ipc/jedec j - std 020d: level 2 for europe level 2a for all other countries verpackung die rolle wird zusammen mit einem trockenmittelbeutel in einem highshield - antistatic - beutel verschwei?t. feuchtigkeitsempfindlichkeitsschwellwert (msl) gem?? j - std 020d: schwellwert 2 fr europa schwellwert 2a fr alle anderen l?nder label etikett order no. bestellnr. xxxxxxxxxx customer order no. kundenspezifische nr. type typ ??? - ??? ??? - ? - ? intensity group intensit?tskgruppe zz color class: cc color class optional farbklasse optional charge no. chargennr. 1122 - aaaaaa quantity anzahl 9999 ? led radiant intensity groups and subgroups [mw/sr] strahlst?rkeklassen und unterklassen ( general information C not this device specific; allgemeine informationen C nicht bauteilspezifisch) n: 28 - 45 n1: 28.00 - 35.50 n2: 35.50 - 45.00 p: 45 - 71 p1: 45 - 56 p2: 56 - 71 q: 71 - 112 q1 : 71 - 90 q2 : 90 - 112 measured according to cie 127. all smd - leds are 100% measured and selected on full automated equipment with an accuracy of 11 %. special service: brightness selection in sub selections possible. color selection in 3 sub selections possible (each subgroup per reel). gemessen nach cie127. alle smd - leds sind 100% gemessen und auf automatischen anlagen mit einer toleranz von 11% selek tiert. spezieller service: selektion der helligkeit in unterklassen auf anfrage m?glich. farbselektion in drei unterklassen m?glich (je eine unterklasse pro spule)
ceramics C high power oci - 440 it940 copyright ? 2013 osa opto light gmbh . all rights reserved www.osa - opto.com edition 5/13 page/seite 7 / 7 attention please the information describes the type of component and shall not considered as assured characteristics. terms of delivery and rights to change reserved. the data sheet may changed without prior information; the valid issue will be on our webpage in internet. due to technical requirements components may contain dangerous substance s. parameters can vary in different applications. all operating parameters must be validated for each customer application by the customer. osa opto light gmbh does not have the responsibility for the reliability and the degradation behaviour of products made with osa opto light gmbh diodes because they depend not only on the diode but also on the conditions of manufacture or design of the final products. the customer is responsible to approve the long term stability of the product according to customers requirements. components used in toys , life support devices or systems or safety devices or systems must be expressly authorized by osa opto light gmbh for such purpose! packaging: osa opto light gmbh uses recyclable packages, p lease use the re cycling operators known to you. zur beachtung dieses datenblatt beschreibt typische, nicht uneingeschr?nkt garantierte bauelementeigenschaften. es gelten die agb der osa opto light gmbh, das recht zur ?nderung dieser ist vorbehalten. ?nderungen im sinne d es technische fortschritts vorbehalten, eine automatische information erfolgt nicht. die jeweils gltige version ist auf unserer internet - seite vorhanden. auf grund technischer erfordernisse k?nnen die bauelemente gef?hrliche substanzen enthalten. produk teigenschaften k?nnen je nach anwendung variieren. die produkteigenschaften mssen in der anwendung durch den kunden geprft werden. die osa opto light gmbh ist nicht fr die zuverl?ssigkeit und das alterungsverhalten von produkten, die unter verwendung vo n von der osa opto light gmbh hergestellten dioden gefertigt wurden, verantwortlich, da beides nicht nur von den dioden selbst, sondern auch von konstruktion und fertigung des endproduktes abh?ngt. der kunde ist verpflichtet, das langzeitverhalten des pro duktes gem?? seiner anforderungen zu prfen und freizugeben. werden die dioden in spielzeug, lebenserhaltenden oder sicherheitsrelevanten systemen und ger?ten eingesetzt, muss dies durch die osa opto light gmbh ausdrcklich gestattest werden. rckgabe von verpackungsmaterial: die osa opto light gmbh verwendet wiederverwertbare verpackung, bitte wenden sie sich an einen ?rtlichen verwerter. osa opto light gmbh www.osa - opto.com k?penicker str.325 / haus 201 12555 berlin germany tel. +49 (0)30 65762683 conta ct@osa - opto.com


▲Up To Search▲   

 
Price & Availability of OCI-440-IT940

All Rights Reserved © IC-ON-LINE 2003 - 2022  

[Add Bookmark] [Contact Us] [Link exchange] [Privacy policy]
Mirror Sites :  [www.datasheet.hk]   [www.maxim4u.com]  [www.ic-on-line.cn] [www.ic-on-line.com] [www.ic-on-line.net] [www.alldatasheet.com.cn] [www.gdcy.com]  [www.gdcy.net]


 . . . . .
  We use cookies to deliver the best possible web experience and assist with our advertising efforts. By continuing to use this site, you consent to the use of cookies. For more information on cookies, please take a look at our Privacy Policy. X